Devin Mccourty Biography, Stats, Career, Net Worth

John Rizzo

Devin McCourty is a professional American football player who currently plays as a safety for the New England Patriots. He was born on August 13, 1987, in Nyack, New York, and went to Saint Joseph Regional for high school before attending Rutgers from 2005 to 2009.

In 2010, he was drafted by the New England Patriots in the first round as the 27th overall pick. McCourty has won three Super Bowl championships, been selected to two Pro Bowls, and named to the second-team All-Pro three times.

He has recorded 966 total tackles, 106 pass deflections, and 34 interceptions as of Week 17, 2022.

Devin McCourty
Source: www.masslive.com

Personal Information of Devin McCourty

Real Name/Full NameDevin McCourty
Age35 years old
Birth Date13 août 1987
Height1,78 m
Weight88 kg
Wife/Spouse (Name)Michelle Powell
ProfessionExpert football player

Stats

Defensive
seasonTeam
2010
NE
2011
NE
2012
NE
2013
NE
2014
NE
2015
NE
2016
NE
2017
NE
2018
NE
2019
NE
2020
NE
2021
NE
2022
NE
Career
GPTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB
168269131200711015.705017350
14876522000023819.003813580
16826319030055310.603413370
1569482102144100.0009260
16685117010027035.00606000
14645113100012727.00275010
168367160113100.00072110
169780171010100.0005230
168259230121418484.01844000
1658461202105499.80247170
16684523000026231.01436220
1760421800003227.301100.500
17715417001046616.5018100
2059717402313127613558116.628411021.5500
Scoring
seasonTeam
2012
NE
2018
NE
2020
NE
Career
GPPASSRUSHRECRETTD2PTPATFGPTS
16000110006
16000110006
160002200012
2050004400024
Returning
seasonTeam
2011
NE
2012
NE
2013
NE
2014
NE
2015
NE
2016
NE
2017
NE
2021
NE
Career
puntskickoffs
GPATTYDSTDFCLNGATTYDSTDKRFCLNG
14000001240024
16000002765410104
150000071320027
16000001270027
140000020000
160000029009
16000002150012
17000002270018
205000004488810104

High school career

Devin McCourty attended Saint Joseph Regional High School in Montvale, New Jersey along with his twin brother Jason. His played defensive football and covered both cornerback and free safety positions.

During his high school years, McCourty earned the distinction of being an all-league selection for his remarkable skills on the field. In his final two seasons, he was recognized as a standout player for his team.

He was known for his excellent tackling abilities and interceptions. As a senior, McCourty had a record of 50 tackles and three interceptions. Beyond his athletic achievements, McCourty also excelled academically in high school.

His determination and dedication to the sport were evident even during his high school time. His skills developed further in college and ultimately led him to a successful career in the NFL.

Devin McCourty’s hard work, both on and off the field, at Saint Joseph contributed to his future achievements in the world of football.

College career

Devin McCourty started his college career at Rutgers University. He played for the Rutgers Scarlet Knights football team. McCourty became a member of the team in 2005. After his first year, he participated in all 13 games as a freshman in 2006.

During this season he recorded 38 tackles and two interceptions. The following year, he played as a cornerback with his twin brother, Jason McCourty. Devin was successful this season, recording 63 tackles, two interceptions, one forced fumble, and three blocked kicks on special teams.

This achievement named him an All-Big East Conference academic selection. He received this recognition in his first two seasons. His college career was a great start for his professional career in football.

Although not much is said about his stats during his last two college years, he gained recognition for his hard work and dedication to the game. Overall, Devin McCourty had a successful college career at Rutgers University.

Professional career

Devin McCourty is a renowned American football player who has had a successful professional career. He began his career by being drafted into the NFL in 2010. McCourty’s talent as a cornerback was quickly recognized, and he began playing for the New England Patriots.

He played remarkably well, earning recognition and praise from fans and experts alike. McCourty’s performance helped his team reach the Super Bowl twice in his career, and they won on both occasions. Throughout his career, Devin McCourty has been regarded as one of the top players in his position.

McCourty’s hard work and dedication have earned him many accolades, including Pro-Bowl selections and All-Pro honors. With his athletic ability and precision-made tackles, McCourty has solidified his place as a key player in the NFL.

Additionally, he has become known for his leadership on and off the field. Devin McCourty’s legacy as a top football player will continue to inspire future generations of players.

NFL career statistics

Devin McCourty is an American football player who currently plays as a free safety for New England Patriots of the National Football League (NFL). He was born and raised in Nyack, New York, along with his twin brother Jason and elder brother Larry White.

Devin and Jason were born just 27 minutes apart, both weighing six pounds and 13 ounces at birth. Before joining the NFL, Devin played college football at Rutgers University. He was picked by the New England Patriots in the first round of the 2010 NFL Draft, making him the 27th overall pick.

Devin quickly established himself as a talented safety and became an integral part of the Patriots’ defense, helping the team win multiple Super Bowls over the years. As of the 2020 NFL season, Devin has played 11 seasons in the league, all with the Patriots.

He has played in a total of 195 regular-season games, recording 711 tackles, 21 interceptions, and 89 passes defended. He has also scored seven touchdowns, six of which came from interceptions and one from a blocked field goal return.

Devin has been named to the Pro Bowl twice in his career and is widely considered one of the best safeties of his generation.

Net Worth

Devin McCourty is a former American football player who had a successful career as a safety for the New England Patriots of the NFL. He was born in Nyack, New York, in 1987 and played college football at Rutgers University, where he was a First-team All-Big East selection in 2009.

He was drafted by the Patriots in the first round of the 2010 NFL Draft and spent his entire 13 seasons with the team. He won three Super Bowls with the Patriots and was selected to two Pro Bowls and three Second-team All-Pro honors. He retired from football in 2023 after suffering a neck injury.

According to various sources, Devin McCourty’s net worth is estimated to be around **$8 million** as of May 2023 . He earned most of his wealth from his football contracts, endorsements, and investments.

He also founded the McCourty Twins Foundation with his twin brother Jason McCourty, who also played in the NFL, to support various charitable causes.

Personal life

Devin McCourty grew up in Nyack, New York, where he was raised by his parents Phyllis and Calvin McCourty. Unfortunately, his father passed away when Devin was young due to complications from asthma. Devin has an older brother named Larry White and a twin brother named Jason McCourt, who was born just 27 minutes after him.

The twins were born weighing six pounds and 13 ounces. When Devin was in junior high school, his family moved into a mobile home in Nanuet, New York. Despite the challenges he faced early in life, McCourty was a standout athlete in high school and went on to play football for Rutgers University.

While in college, Devin met his future wife, Michelle. After college, he was drafted to the New England Patriots and has since become a defensive captain and two-time Pro Bowler. Off the field, Devin is actively involved in philanthropy and social justice causes.

He and Michelle have two children together, a son and a daughter. In 2010, his mother retired from her career as a nurse at Rockland Psychiatric Hospital in Orangeburg, New York.

Is Devin McCourty going to the Hall of Fame?

Devin McCourty was recently honored in a ceremony at the Patriots Hall of Fame. He is a three-time Super Bowl champion who played for 13 years with the New England team. At the ceremony, the owner Robert Kraft, head coach Bill Belichick, and several teammates from his career were present to reminisce about the good times with McCourty.

Although there is no mention that McCourty is going to the Hall of Fame, the fact that he was honored at the Patriots Hall of Fame suggests that he has made an impact on the team. McCourty is known for his versatility, as he can play both cornerback and safety positions.

He has also been recognized for his leadership and community involvement. However, being inducted into the Hall of Fame is a major accomplishment that requires a strong and consistent performance throughout one’s career.

McCourty’s overall career achievements and impact on the NFL will determine if he is a future candidate for the Hall of Fame.

Does Devin McCourty have sickle cell?

Devin McCourty, the New England Patriots’ safety, has sickle cell trait. It is a genetic blood disorder in which hemoglobin, a protein in red blood cells, becomes abnormal and makes red blood cells stiff and sickle-shaped.

Sickle cells can block blood flow, leading to pain and other complications. People with sickle cell trait usually do not have symptoms, but there are instances where they experience cramping, exhaustion, and dehydration during intense physical activity.

Despite having sickle cell trait, McCourty has not let it stop him from excelling on the football field, and he advocates for research and education to raise awareness about sickle cell.

Is Devin McCourty leaving the Patriots?

After a successful 11-year career, Devin McCourty has decided to retire from football. An integral part of the New England Patriots, McCourty’s announcement of his departure has come as a surprise to many fans.

Throughout his time as a safety for the team, McCourty was known for his impressive leadership skills and athletic abilities. He was highly respected by his teammates, coaches, and fans alike. Despite his retirement, McCourty’s impact on the Patriots will be remembered for years to come.

He made significant contributions to the team’s success on the field, helping them win three Super Bowl titles throughout his career. McCourty’s retirement will leave a significant void in the Patriots’ defense, and his presence both on and off the field will be sorely missed.

Nevertheless, we are sure that Devin McCourty will move on to great things in his next chapter, just as he did throughout his time with the Patriots.

How many children does Devin McCourty have?

Devin McCourty, an American football player, is a father to two children. Here are some bullet points with headings:

Devin McCourty:

  • Former Rutgers player
  • Played for the New England Patriots since 2010
  • Has won three Super Bowl championships with the Patriots
  • Named a team captain multiple times
  • Started the McCourty Twins Tackle Sickle Cell campaign with his twin brother
  • Grew up in New Jersey
  • Married to Michelle Powell since 2016
  • Also has a twin brother who plays in the NFL
  • Supports various charitable causes through his foundation
  • Is a respected leader on and off the football field

Who has more Hall of Fame players?

Different NFL teams have varying numbers of players in the Hall of Fame. The Green Bay Packers have the most with 24 inductees. The Pittsburgh Steelers are next with 22, followed by the Chicago Bears with 28.

Other teams with high numbers of Hall of Fame players include the New York Giants (20), Washington Football Team (19), and the Dallas Cowboys (18).

In contrast, there are six teams that have only one Hall of Fame player: the Houston Texans, Jacksonville Jaguars, and Cleveland Browns, among them. Having more Hall of Fame players signifies a team’s sustained excellence on and off the field.

To Recap

Devin McCourty is an American football player, currently playing for the New England Patriots in the National Football League (NFL). He was born on August 13, 1987, in Nyack, New York. The 5 ft 10 in tall and 195 lb heavy player played college football for Rutgers University.

He was a first-round pick in the 2010 NFL Draft, chosen by the Patriots. He has won three Super Bowl championships with the team and has been named to the Pro Bowl twice. As a defensive player, he has impressive stats, including 966 total tackles, 106 pass deflections, and 34 interceptions.

Photo of author

John Rizzo

I am a professional rugby player in the Washington DC-Baltimore area. I have been playing rugby for over 10 years and have had the opportunity to play in many different countries. I am also a coach for both youth and adult rugby teams. I graduated from Johns Hopkins University with a degree in Sports Management and Marketing. I am currently working on my MPA from American University and plan to pursue this career path after graduating next year. LinkedIn

Leave a Comment